PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26209.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 389aa    MW: 44061.9 Da    PI: 7.4301
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26209.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
       KHN26209.1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding43.86.1e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+  +v++++ lG++ W+ Ia+ ++ gRt++++k+ w++
       KHN26209.1  67 RGAFSQQEENMIVELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466892.12E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002492.8E-161461IPR001005SANT/Myb domain
CDDcd001671.13E-111761No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.8566116IPR017930Myb domain
SMARTSM007173.5E-1266114IPR001005SANT/Myb domain
PfamPF002491.3E-1267111IPR001005SANT/Myb domain
CDDcd001673.02E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENMIVE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPNTHKPLS EVENEKDMMP PSTDKSTQKA SVGSNEVWYP HHHHHHDHNN NTSDVVGSYF  180
SFQHLNYGTT TNMSLSANPN ASLCFVPAST SSDLNNNSTI TSSMLPSIFP TQHVKLQSNN  240
NNPSISSDGV QNWETSNLNN SNSTNKNNGS MQLQSCTNFI DNTWGVGESM KVVNINKDAD  300
QMPLQAEQED LKWSEYLNTP FILGNNTAQN HQIQTSQSIY SEVKPETGFI TDESCATWHH  360
YQNQTPAFQL SDIYSKDLQR FSVTFGQTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121165108B-MYB
1h8a_C9e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312060.0KT031206.1 Glycine max clone HN_CCL_131 MYB/HD-like transcription factor (Glyma20g22230.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555168.10.0PREDICTED: transcription factor MYB86
RefseqXP_006605773.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0B2R1U70.0A0A0B2R1U7_GLYSO; Transcription factor MYB86
STRINGGLYMA20G22230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-114myb domain protein 61
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]